PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000237596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 304aa    MW: 34577.8 Da    PI: 6.0672
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000237596genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.3e-131156146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ vk+ G+++W++I ++  + Rt+k+c++rw +
    MDP0000237596 11 KGPWKAEEDEVLLNHVKKCGPRDWSSIRSKGLLQRTGKSCRLRWVN 56
                     79*************************8887799**********87 PP

2Myb_DNA-binding41.72.6e-1367106344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++ eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
    MDP0000237596  67 KFSVEEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 106
                      799*****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.075662IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-20659IPR009057Homeodomain-like
SuperFamilySSF466895.86E-288106IPR009057Homeodomain-like
SMARTSM007175.3E-101060IPR001005SANT/Myb domain
CDDcd001671.29E-101358No hitNo description
PfamPF139211.8E-111464No hitNo description
Gene3DG3DSA:1.10.10.601.1E-1760112IPR009057Homeodomain-like
PROSITE profilePS5129418.31563114IPR017930Myb domain
SMARTSM007174.4E-1264112IPR001005SANT/Myb domain
PfamPF002491.2E-1167106IPR001005SANT/Myb domain
CDDcd001673.49E-1067106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEGKKEEGIR KGPWKAEEDE VLLNHVKKCG PRDWSSIRSK GLLQRTGKSC RLRWVNKLRP  60
NLKNGCKFSV EEERVVIELQ AQFGNKWARI ATYLPGRTDN DVKNFWSSRQ KRLARILQTP  120
TAITFSSKSH KTRREAPKFN CSSEGEPSSQ APSCSSPPPY IRNSEIIKMV PLPDIVKPES  180
ICFXTNPVQH ELTITDKDPW NESQSVIPFL QNPQPQTDLF SSETQELLAR FDPYFDMLVP  240
LDASELGNGE PLPMEPPLFE PVGSCVSCER EQIDHTMAPD CLFXDFPTDM FDQLDPLPNI  300
SGQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-26911225126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356546.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLM5VT831e-155M5VT83_PRUPE; Uncharacterized protein
STRINGVIT_15s0021g02040.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.19e-83MYB family protein